PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA016635-PA
Common NameOsI_16382, rml1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 385aa    MW: 41926.8 Da    PI: 6.0253
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA016635-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix859e-2749117270
          trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekk 70 
                       W ++e+l+Li++rrem+++++++k++k+lWe++s++mre+gf rsp++C++kw+nl k++kk + ++++
  BGIOSGA016635-PA  49 WVQDETLCLIALRREMDSHFNTSKSNKHLWEAISARMREQGFDRSPTMCTDKWRNLLKEFKKARSHARG 117
                       ***************************************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.29341105IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.0E-442109IPR009057Homeodomain-like
SMARTSM007172.5E-545107IPR001005SANT/Myb domain
CDDcd122033.88E-2847112No hitNo description
PfamPF138373.9E-1848119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MLLSGPSPQQ PTPPLLLPES SGEDGGHDSS SRAAASGGGG GPKKRAETWV QDETLCLIAL  60
RREMDSHFNT SKSNKHLWEA ISARMREQGF DRSPTMCTDK WRNLLKEFKK ARSHARGGGG  120
GGVGGGGAGT GGGNCPAKMA CYKEIDDLLK RRGKPTGGGG AAVGSGAVKS PTVTSKIDSY  180
LQFDKGFEDA SIPFGPVEAS GRSLLSVEDR LEPDSHPLAL TADAVATNGV NPWNWRDTST  240
NGGDNQVTFG GRVILVKWGD YTKRIGIDGT ADAIKEAIKS AFGLRTRRAF WLEDEDEVVR  300
SLDRDMPVGT YTLHLDTGMT IKLYMFENDE VRTEDKTFYT EEDFRDFLSR RGWTLLREYS  360
GYRIADTLDD LRPGVIYEGM RSLGD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A5e-3843144186DNA binding protein GT-1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.189630.0callus| flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO273688960.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00640PBMTransfer from MDP0000164819Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1032960.0AK103296.1 Oryza sativa Japonica Group cDNA clone:J033125B02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635625.10.0PREDICTED: trihelix transcription factor GT-1
SwissprotQ9FX531e-141TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLJ3JRU50.0J3JRU5_ORYSA; H0302E05.1 protein
TrEMBLA0A0D9ZMC80.0A0A0D9ZMC8_9ORYZ; Uncharacterized protein
TrEMBLQ8GT420.0Q8GT42_ORYSI; RML1 protein
TrEMBLQ7XUC20.0Q7XUC2_ORYSJ; OJ000223_09.13 protein
STRINGBGIOSGA016635-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os04g40930.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56313752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.11e-135Trihelix family protein
Publications ? help Back to Top
  1. Wang R,Hong G,Han B
    Transcript abundance of rml1, encoding a putative GT1-like factor in rice, is up-regulated by Magnaporthe grisea and down-regulated by light.
    Gene, 2004. 324: p. 105-15
    [PMID:14693376]